Web Analysis for Steadmanhawkinsclinicdenverfellowship - steadmanhawkinsclinicdenverfellowship.org
CU Sports Medicine is pleased to offer two 1-year post-graduate experiences in orthopaedic sports medicine and shoulder surgery.
steadmanhawkinsclinicdenverfellowship.org is 3 years 3 months old. It is a domain having org extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, steadmanhawkinsclinicdenverfellowship.org is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 4 |
H3 Headings: | 5 | H4 Headings: | 6 |
H5 Headings: | 1 | H6 Headings: | 1 |
Total IFRAMEs: | 1 | Total Images: | 5 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 184.168.131.241)
ImageShack - Best place for all of your image hosting and image sharin
Unlimited space to host images, easy to use image uploader, albums, photo hosting, sharing, dynamic image resizing on web and mobile.
مجلة سيدتي | الصفحة الرئيسية
سيدتي نت موقع لمجلة المرأة العربية يطرح قضايا ونصائح خاصة بالمرأة والمجتمع في مختلف المجالات. سواء في الصحة، التغذية، الجمال، الأزياء، الرشاقة، المطبخ والأطفال.
The Best YouTube to MP3 Converter - IXConverter.com
Download and Convert your favorite online videos and audio to MP3, MP4, WEBM, F4V, and 3GP formats for free!
Haber365 | Haber, Haberler, Son Dakika Haberleri
Haber365, güncel haberler, haber, en son haber, son dakika haberler ve 365 gün tüm kategorilerde güncel gelişmeler haber sitesi Haber365.com.tr'de.
HTTP Header Analysis
Cache-Control: public, max-age=43200, s-maxage=43200
Content-Type: text/html; charset=utf-8
Expires: Sat, 23 Jan 2021 08:40:51 GMT
Last-Modified: Fri, 22 Jan 2021 20:40:51 GMT
ETag: "74fd8b75-ec4b-4db6-9461-ca4033a5d1cd"
Vary: *, Accept-Encoding
Server: Microsoft-IIS/8.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Fri, 22 Jan 2021 20:40:50 GMT
Content-Length: 20053
Content-Encoding: gzip
Connection: Keep-Alive
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns33.domaincontrol.com | 97.74.106.17 | United States of America | |
ns34.domaincontrol.com | 173.201.74.17 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
steadmanhawkinsclinicdenverfellowship.org | A | 588 |
IP: 184.168.131.241 |
steadmanhawkinsclinicdenverfellowship.org | NS | 3600 |
Target: ns33.domaincontrol.com |
steadmanhawkinsclinicdenverfellowship.org | NS | 3600 |
Target: ns34.domaincontrol.com |
steadmanhawkinsclinicdenverfellowship.org | SOA | 3600 |
MNAME: ns33.domaincontrol.com RNAME: dns.jomax.net Serial: 2021012101 Refresh: 28800 Retry: 7200 Expire: 604800 Minimum TTL: 600 |
Full WHOIS Lookup
Registry Domain ID: D402200000015780287-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2021-01-21T13:07:06Z
Creation Date: 2021-01-21T13:07:04Z
Registrar Registration Expiration Date: 2023-01-21T13:07:04Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization:
Registrant State/Province: North Carolina
Registrant Country: US
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=steadmanhawkinsclinicdenverfellowship.org
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=steadmanhawkinsclinicdenverfellowship.org
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=steadmanhawkinsclinicdenverfellowship.org
Name Server: NS33.DOMAINCONTROL.COM
Name Server: NS34.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-01-22T20:00:00Z <<<
For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en
TERMS OF USE: The data contained in this registrar's Whois database, while believed by the
registrar to be reliable, is provided "as is" with no guarantee or warranties regarding its
accuracy. This information is provided for the sole purpose of assisting you in obtaining
information about domain name registration records. Any use of this data for any other purpose
is expressly forbidden without the prior written permission of this registrar. By submitting
an inquiry, you agree to these terms and limitations of warranty. In particular, you agree not
to use this data to allow, enable, or otherwise support the dissemination or collection of this
data, in part or in its entirety, for any purpose, such as transmission by e-mail, telephone,
postal mail, facsimile or other means of mass unsolicited, commercial advertising or solicitations
of any kind, including spam. You further agree not to use this data to enable high volume, automated
or robotic electronic processes designed to collect or compile this data for any purpose, including
mining this data for your own personal or commercial purposes. Failure to comply with these terms
may result in termination of access to the Whois database. These terms may be subject to modification
at any time without notice.